SKP1 Fragment MS Protein Standard

S-phase kinase-associated protein 1

SKP1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SKP1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SKP1

Cyclin-A/CDK2-associated protein p19, Organ of Corti protein 2, Organ of Corti protein II, RNA polymerase II elongation factor-like protein, SIII, Transcription elongation factor B polypeptide 1-like, p19skp1

P63208

MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKE