SLC15A2 Fragment MS Protein Standard

Solute carrier family 15 member 2

SLC15A2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SLC15A2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SLC15A2

Kidney H(+)/peptide cotransporter, Oligopeptide transporter, kidney isoform, Peptide transporter 2

Q16348

GPQEVFLQVLNLADDEVKVTVVGNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSVQEKNWYSLVIREDGNSISSMMVKDTESRTTNGMTTVRFVNTLHKDVNISLSTDTSLNVGEDYGVSAYRTVQRGEYP