SLC26A9 Fragment MS Protein Standard

Solute carrier family 26 member 9

SLC26A9 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SLC26A9 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SLC26A9

Anion transporter/exchanger protein 9

Q7LBE3

MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRC