SLC27A5 Fragment MS Protein Standard

Product Information
Protein Name
Bile acyl-CoA synthetase
Description
SLC27A5 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SLC27A5 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
SLC27A5
Synonyms
Bile acid-CoA ligase, Cholate--CoA ligase, Fatty acid transport protein 5, Fatty-acid-coenzyme A ligase, very long-chain 3, Solute carrier family 27 member 5, Very long-chain acyl-CoA synthetase homolog 2, Very long-chain acyl-CoA synthetase-related prote
Uniprot ID
Q9Y2P5
Product Sequence
QPPDTFVDAFERRARAQPGRALLVWTGPGAGSVTFGELDARACQAAWALKAELGDPASLCA

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2026 Creative Proteomics. All rights reserved.
2
Inquiry Basket