SMCO3 Fragment MS Protein Standard

Product Information
Protein Name
Single-pass membrane and coiled-coil domain-containing protein 3
Description
SMCO3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SMCO3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
SMCO3
Synonyms
5-tyrosyl-DNA phosphodiesterase, ETS1-associated protein 2, ETS1-associated protein II, TRAF and TNF receptor-associated protein, Tyrosyl-RNA phosphodiesterase, VPg unlinkase
Uniprot ID
A2RU48
Product Sequence
KELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLV

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2025 Creative Proteomics. All rights reserved.
2
Inquiry Basket