SMPDL3B Fragment MS Protein Standard

Acid sphingomyelinase-like phosphodiesterase 3b

SMPDL3B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SMPDL3B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SMPDL3B

Protein Odd Oz/ten-m homolog 1, Tenascin-M1, Teneurin transmembrane protein 1

Q92485

AGSNNIYNQIAELWKPWLSNESIALFKKGAFYCEKLPGPSGAGRIVVLNTNLYYTSNALTADMADPGQQFQWLEDVLTD