SNX14 Fragment MS Protein Standard

Product Information
Protein Name
Sorting nexin-14
Description
SNX14 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SNX14 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
SNX14
Synonyms
BSC-1 cell growth inhibitor, Cetermin, Glioblastoma-derived T-cell suppressor factor, Polyergin
Uniprot ID
Q9Y5W7
Product Sequence
AMKHIEVIVKARQKVKNTEFLQQAALEEYGPELHVALRSRRDELHYLRKLTELLFPYILPPKATDCRSLTLLIREILSGSVFLPSLDFLADPDTVNHLLIIFIDDSPPEKA

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2026 Creative Proteomics. All rights reserved.
2
Inquiry Basket