SOCS5 Fragment MS Protein Standard

Suppressor of cytokine signaling 5

SOCS5 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SOCS5 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SOCS5

Cytokine-inducible SH2 protein 6, Cytokine-inducible SH2-containing protein 5

O75159

HSCSTKTQSSLDADKKFGRTRSGLQRRERRYGVSSVHDMDSVSSRTVGSRSLRQRLQDTVGLCFPMRTYSKQSKP