SOX13 Fragment MS Protein Standard

Transcription factor SOX-13

SOX13 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SOX13 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SOX13

Islet cell antigen 12, SRY (Sex determining region Y)-box 13, Type 1 diabetes autoantigen ICA12

Q9UN79

DVLYPRAAGMPLAQPLVEHYVPRSLDPNMPVIVNTCSLREEGEGTDDRHSVADGEMYRYSEDEDSEGEEKSDGELVVLT