ST14 Fragment MS Protein Standard

Suppressor of tumorigenicity 14 protein

ST14 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ST14 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ST14

Matriptase, Membrane-type serine protease 1, Prostamin, Serine protease 14, Serine protease TADG-15, Tumor-associated differentially-expressed gene 15 protein

Q9Y5Y6

VFNGYMRITNENFVDAYENSNSTEFVSLASKVKDALKLLYSGVPFLGPYHKESAVTAFSEGSVIAYYWSEFSIPQHLVE