ST6GALNAC2 Fragment MS Protein Standard

Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2

ST6GALNAC2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ST6GALNAC2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ST6GALNAC2

GalNAc alpha-2,6-sialyltransferase II, ST6GalNAc II, SThM, Sialyltransferase 7B

Q9UJ37

DTTSFEAFFQSKASNSWTGKGQACRHLLHLAIQRHPHFRGLFNLSIPVLLWGDLFTPALWDRLSQHKAPYGWRGLSHQVIASTLSLLNGSESAKLFAPPRDTPPKCIRCAV