SUCLA2 Fragment MS Protein Standard

Succinyl-CoA ligase [ADP-forming] subunit beta, mitochondrial

SUCLA2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SUCLA2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SUCLA2

ATP-specific succinyl-CoA synthetase subunit beta, Renal carcinoma antigen NY-REN-39, Succinyl-CoA synthetase beta-A chain

Q9P2R7

FGGIMRCDVIAQGIVMAVKDLEIKIPVVVRLQGTRVDDAKALIADSGLKILACDDLDEAARMVVKLSEIVTLAKQAHVDVKFQLP