SUPT5H Fragment MS Protein Standard

Transcription elongation factor SPT5

SUPT5H Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human SUPT5H protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

SUPT5H

DRB sensitivity-inducing factor 160 kDa subunit, DRB sensitivity-inducing factor large subunit, Tat-cotransactivator 1 protein

O00267

ERETFQVLNMYGKVVTVRHQAVTRKKDNRFAVALDSEQNNIHVKDIVKVIDGPHSGREGEIRHLFRSFAFLHCKKLVENGGMFVCKTRHLVLAGGSKPRDVTNFTVGGFAPMSPRI