TAB3 Fragment MS Protein Standard

TGF-beta-activated kinase 1 and MAP3K7-binding protein 3

TAB3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TAB3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TAB3

Mitogen-activated protein kinase kinase kinase 7-interacting protein 3, NF-kappa-B-activating protein 1, TAK1-binding protein 3, TGF-beta-activated kinase 1-binding protein 3

Q8N5C8

QPKPPFSVNPVYITYTQPTGPSCTPSPSPRVIPNPTTVFKITVGRATTENLLNLVDQEERSAAPEPIQPISVIPGSGGEKGSHKYQRSSSSGSDDYA