TAF5L Fragment MS Protein Standard

TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L

TAF5L Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TAF5L protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TAF5L

PCAF-associated factor 65 beta

O75529

MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYP