TANGO6 Fragment MS Protein Standard

Transport and Golgi organization protein 6 homolog

TANGO6 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TANGO6 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TANGO6

Transmembrane and coiled-coil domain-containing protein 7

Q9C0B7

LKELTHVASENETELKTEPFSSKSLLELEQHQTLLVEGQERKLLVLQLMAVLCERMSEQIFTNVTQVVDFVAATLQRACASLAHQAESTVESQTLS