TCEB1 Fragment MS Protein Standard

Transcription elongation factor B polypeptide 1

TCEB1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TCEB1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TCEB1

Elongin 15 kDa subunit, Elongin-C, RNA polymerase II transcription factor SIII subunit C, SIII p15

Q15369

ETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEI