TDRD12 Fragment MS Protein Standard

Putative ATP-dependent RNA helicase TDRD12

TDRD12 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TDRD12 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TDRD12

ES cell-associated transcript 8 protein, Tudor domain-containing protein 12

Q587J7

KPADNEIEWNPKVTRYIHHKIVGKLHDAKVILALGNTVWIDPMVHITNLSSLKTSVIDYNVRAEILSMGMGIDNPEHIEQLKKLREDAKIPACE