TERT Fragment MS Protein Standard

Telomerase reverse transcriptase

TERT Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TERT protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TERT

HEST2, Telomerase catalytic subunit, Telomerase-associated protein 2

O14746

GVLLKTHCPLRAAVTPAAGVCAREKPQGSVAAPEEEDTDPRRLVQLLRQHSSPWQVYGFVRACLRRLVPPGLWGSRHNERRFLRNTKKFISLGKHAKLS