TET1 Fragment MS Protein Standard

Methylcytosine dioxygenase TET1

TET1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TET1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TET1

CXXC-type zinc finger protein 6, Leukemia-associated protein with a CXXC domain, Ten-eleven translocation 1 gene protein

Q8NFU7

VPPNPIATFNAPSKWPEPQSTVSYGLAVQGAIQILPLGSGHTPQSSSNSEKNSLPPVMAISNVENEKQVHISFLPANTQGFPLAPERGLFHASLGIAQLSQAGPSKSDRGSSQVSVTSTVHVVNTTVVTMPVPMVSTSSSSYTT