TICRR Fragment MS Protein Standard

Treslin

TICRR Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TICRR protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TICRR

TopBP1-interacting checkpoint and replication regulator, TopBP1-interacting, replication-stimulating protein

Q7Z2Z1

PSKVGKRCRKTSDPRRSIVECQPDASATPGVGTADSPAAPTDSRDDQKGLSLSPQSPPERRGYPGPGLRSDWHASSPLLITSDTEHVTLLSEAEHH