TMED6 Fragment MS Protein Standard

Transmembrane emp24 domain-containing protein 6

TMED6 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TMED6 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TMED6

p24 family protein gamma-5

Q8WW62

GDQPLFRGADRYDFAIMIPPGGTECFWQFAHQTGYFYFSYEVQRTVGMSHDRHVAATAHNPQGFLIDTSQGVRGQINFSTQETGFYQLCLSNQHNHFGSVQVYLNFGVFYEGPETDHKQKERKQLNDTLDAIEDGTQKV