TMX2 Fragment MS Protein Standard

Thioredoxin-related transmembrane protein 2

TMX2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TMX2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TMX2

Cell proliferation-inducing gene 26 protein, Thioredoxin domain-containing protein 14

Q9Y320

ENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK