TRIM2 Fragment MS Protein Standard

Tripartite motif-containing protein 2

TRIM2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TRIM2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TRIM2

E3 ubiquitin-protein ligase TRIM2, RING finger protein 86

Q9C040

PMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYTVQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPT