TRIM23 Fragment MS Protein Standard

E3 ubiquitin-protein ligase TRIM23

TRIM23 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TRIM23 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TRIM23

ADP-ribosylation factor domain-containing protein 1, GTP-binding protein ARD-1, RING finger protein 46, Tripartite motif-containing protein 23

P36406

QHIEGGEQIVEDGIGMAHTEHVPGTAENARSCIRAYFYDLHETLCRQEEMALSVVDAHVREKLIWLRQQQEDMTILL