TRIM39 Fragment MS Protein Standard

E3 ubiquitin-protein ligase TRIM39

TRIM39 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TRIM39 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TRIM39

RING finger protein 23, Testis-abundant finger protein, Tripartite motif-containing protein 39

Q9HCM9

SRKGELTPLPETGYWRVRLWNGDKYAATTTPFTPLHIKVKPKRV