TRIM69 Fragment MS Protein Standard

E3 ubiquitin-protein ligase TRIM69

TRIM69 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TRIM69 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TRIM69

RFP-like domain-containing protein trimless, RING finger protein 36, Tripartite motif-containing protein 69

Q86WT6

GDYVEMNDSITHLPSKVVIQDITMELHCPLCNDWFRDPLMLSCGHNFCEACIQDFWRLQAKETFCPECKMLCQYNNCTFNPVLDKLVEKIKKLPLLKGHPQCPEHGENLKL