TWIST2 Fragment MS Protein Standard

Twist-related protein 2

TWIST2 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TWIST2 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TWIST2

Class A basic helix-loop-helix protein 39, Dermis-expressed protein 1

Q8WVJ9

ELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRIL