TXNRD1 Fragment MS Protein Standard

Thioredoxin reductase 1, cytoplasmic

TXNRD1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TXNRD1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TXNRD1

Gene associated with retinoic and interferon-induced mortality 12 protein, KM-102-derived reductase-like factor, Thioredoxin reductase TR1

Q16881

GFDQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVML