TYRO3 Fragment MS Protein Standard

Tyrosine-protein kinase receptor TYRO3

TYRO3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human TYRO3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

TYRO3

Tyrosine-protein kinase BYK, Tyrosine-protein kinase DTK, Tyrosine-protein kinase RSE, Tyrosine-protein kinase SKY, Tyrosine-protein kinase TIF

Q06418

RPSFTCLRMELENILGQLSVLSASQDPLYINIERAEEPTAGGSLELPGRDQPYSGAGDGSGMGAVGGTPSDCRY