UBA3 Fragment MS Protein Standard

NEDD8-activating enzyme E1 catalytic subunit

UBA3 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human UBA3 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

UBA3

NEDD8-activating enzyme E1C, Ubiquitin-activating enzyme E1C, Ubiquitin-like modifier-activating enzyme 3

Q8TBC4

VVPHFNKIQDFNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLIDGGTEGFKGNARVILPGMTACIECTLE