UBE2M Fragment MS Protein Standard

NEDD8-conjugating enzyme Ubc12

UBE2M Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human UBE2M protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

UBE2M

NEDD8 carrier protein, NEDD8 protein ligase, Ubiquitin-conjugating enzyme E2 M

P61081

KLFSLKQQKKEEESAGGTKGSSKKASAAQLRIQKDINELNLPKTCDISFSDPDDLLNFKLVICPDEGFYKSGKFVFSFKVGQ