UBE2Z Fragment MS Protein Standard

Product Information
Protein Name
Ubiquitin-conjugating enzyme E2 Z
Description
UBE2Z Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human UBE2Z protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
UBE2Z
Synonyms
Uba6-specific E2 conjugating enzyme 1, Ubiquitin carrier protein Z, Ubiquitin-protein ligase Z
Uniprot ID
Q9H832
Product Sequence
AALLSHWDPTLSSDWDGERTAPQCLLRIKRDIMSIYKEPPPGMFVVPDTVDMTKIHALIT

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2025 Creative Proteomics. All rights reserved.
2
Inquiry Basket