UGT1A6 Fragment MS Protein Standard

UDP-glucuronosyltransferase 1-6

UGT1A6 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human UGT1A6 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

UGT1A6

Phenol-metabolizing UDP-glucuronosyltransferase, UDP-glucuronosyltransferase 1-F, UDP-glucuronosyltransferase 1A6

P19224

YFINCQSLLQDRDTLNFFKESKFDALFTDPALPCGVILAEYLGLPSVYLFRGFPCSLEHTFSRSPDPVSYIPRCYTKF