UHRF1 Fragment MS Protein Standard

Product Information
Protein Name
E3 ubiquitin-protein ligase UHRF1
Description
UHRF1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human UHRF1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
UHRF1
Synonyms
Inverted CCAAT box-binding protein of 90 kDa, Nuclear protein 95, Nuclear zinc finger protein Np95, RING finger protein 106, Transcription factor ICBP90, Ubiquitin-like PHD and RING finger domain-containing protein 1, Ubiquitin-like-containing PHD and RIN
Uniprot ID
Q96T88
Product Sequence
RARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDE

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2025 Creative Proteomics. All rights reserved.
2
Inquiry Basket