UNC45A Fragment MS Protein Standard

Protein unc-45 homolog A

UNC45A Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human UNC45A protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

UNC45A

GCUNC-45, Smooth muscle cell-associated protein 1

Q9H3U1

RSNGVQLLQRLLDMGETDLMLAALRTLVGICSEHQSRTVATLSILGTRRVVSILGVESQAVSLAACHLLQVMFDALKEGVKKGFRGKEGAIIVD