UNK Fragment MS Protein Standard

RING finger protein unkempt homolog

UNK Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human UNK protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

UNK

Zinc finger CCCH domain-containing protein 5

Q9C0B0

IYKSTKCNDMQQSGSCPRGPFCAFAHVEQPPLSDDLQPSSAVSSPTQPGPVLYMPSAAGDSVPVSPSSPHAPDLSALLCRNSSLGSPSNLCGSPPGSIRKPPNLEGIVFPGES