UPF3B Fragment MS Protein Standard

Regulator of nonsense transcripts 3B

UPF3B Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human UPF3B protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

UPF3B

Nonsense mRNA reducing factor 3B, Up-frameshift suppressor 3 homolog B, Up-frameshift suppressor 3 homolog on chromosome X

Q9BZI7

KEEKEHRPKEKRVTLLTPAGATGSGGGTSGDSSKGEDKQDRNKEKKEALSKVVIRRLPPTLTKEQLQEHLQPMPEHDYFEFFSNDTSLYPHMYARAYINFKNQEDIILFRDRFDGYVF