USP19 Fragment MS Protein Standard

Ubiquitin carboxyl-terminal hydrolase 19

USP19 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human USP19 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

USP19

Deubiquitinating enzyme 19, Ubiquitin thioesterase 19, Ubiquitin-specific-processing protease 19, Zinc finger MYND domain-containing protein 9

O94966

KNDSYEKGPDSVVVHVYVKEICRDTSRVLFREQDFTLIFQTRDGNFLRLHPGCGPHTTFRWQVKLRNLIEPEQCTFCFTASRI