USP47 Fragment MS Protein Standard

Ubiquitin carboxyl-terminal hydrolase 47

USP47 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human USP47 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

USP47

Deubiquitinating enzyme 47, Ubiquitin thioesterase 47, Ubiquitin-specific-processing protease 47

Q96K76

PTKQVMMENKLEVHKDKTLKEAVEMAYKMMDLEEVIPLDCCRLVKYDEFHDYLERSYEGEEDTPMGLLLGGVKSTYMFDLLLETR