VIPAS39 Fragment MS Protein Standard

Product Information
Protein Name
Spermatogenesis-defective protein 39 homolog
Description
VIPAS39 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human VIPAS39 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
VIPAS39
Synonyms
VPS33B-interacting protein in apical-basolateral polarity regulator, VPS33B-interacting protein in polarity and apical restriction
Uniprot ID
Q9H9C1
Product Sequence
SDTPAKSYAPELGRPKGEYRDYSNDWSPSDTVRRLRKGKVCSLERFRSLQDKLQLLEEAVSMHDGNVITAVLIFLKRTLSKEILFRELEVRQVALRHLIHFLKEIGDQKLLLDLFRFLDR

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
2
Inquiry Basket