VPS41 Fragment MS Protein Standard

Vacuolar protein sorting-associated protein 41 homolog

VPS41 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human VPS41 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

VPS41

S53

P49754

DPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLKKMHRTQMKGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSAKNRGPGSAILEM