VTA1 Fragment MS Protein Standard

Vacuolar protein sorting-associated protein VTA1 homolog

VTA1 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human VTA1 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

VTA1

Dopamine-responsive gene 1 protein, LYST-interacting protein 5, SKD1-binding protein 1

Q9NP79

FKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA