WBP4 Fragment MS Protein Standard

Product Information
Protein Name
WW domain-binding protein 4
Description
WBP4 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human WBP4 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.
Symbol
WBP4
Synonyms
Formin-binding protein 21, WW domain-containing-binding protein 4
Uniprot ID
O75554
Product Sequence
YCKCWIADNRPSVEFHERGKNHKENVAKRISEIKQKSLDKAKEEEKASKEFAAMEAAALKAYQEDLKRLGLESEILEPSITPVTSTIPPTSTSNQQKEK

If the product of interest is not available in our catalog, we can synthesize for you with our quality controlled Customized Synthesized Peptide/Proteins Service!

* This product is For Research Use Only. Do Not use in diagnostic or therapeutic procedures.
Related Products
Copyright © 2025 Creative Proteomics. All rights reserved.
2
Inquiry Basket