WLS Fragment MS Protein Standard

Protein wntless homolog

WLS Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human WLS protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

WLS

Integral membrane protein GPR177, Protein evenness interrupted homolog, Putative NF-kappa-B-activating protein 373

Q5T9L3

LAYRDDAFAEWTEMAHERVPRKLKCTFTSPKTPEHEGRYYECDVLPFMEIGSVAHKFYLLNIRLPVNEKKKINVGIGEIKD