ZC3H14 Fragment MS Protein Standard

Zinc finger CCCH domain-containing protein 14

ZC3H14 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ZC3H14 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ZC3H14

Mammalian suppressor of tau pathology-2, Renal carcinoma antigen NY-REN-37

Q6PJT7

RPSIEIYRPPASRNADSGVHLNRLQFQQQQNSIHAAKQLDMQSSWVYETGRLCEPEVLNSLEETYSPFFRNNSEKMSMEDENFRKRKL