ZFYVE20 Fragment MS Protein Standard

Rabenosyn-5

ZFYVE20 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ZFYVE20 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ZFYVE20

110 kDa protein, FYVE finger-containing Rab5 effector protein rabenosyn-5, Zinc finger FYVE domain-containing protein 20

Q9H1K0

IMCKKCMELISLPLANKLTSASKESLSTHTSPSQSPNSVHGSRRGSISSMSSVSSVLDEKDDDRIRCCTHCKDTLLKREQQIDEKEHTPDIVKLYEKLR