ZMYND11 Fragment MS Protein Standard

Zinc finger MYND domain-containing protein 11

ZMYND11 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ZMYND11 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ZMYND11

Adenovirus 5 E1A-binding protein, Bone morphogenetic protein receptor-associated molecule 1, Protein BS69

Q15326

KKKNTNKQEMGTYLRFIVSRMKERAIDLNKKGKDNKHPMYRRLVHSAVDVPTIQEKVNEGKYRSYEEFKADAQLLLHNTVIFYGAD