ZSWIM7 Fragment MS Protein Standard

Zinc finger SWIM domain-containing protein 7

ZSWIM7 Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ZSWIM7 protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ZSWIM7

SWIM domain-containing and Srs2-interacting protein 1 homolog, SWIM-type zinc finger domain-containing protein 7

Q19AV6

CLASCHYCSCPAFAFSVLRKSDSILCKHLLAVYLSQVMRTCQQLSVSDKQLTDILLMEKKQEA