ZUFSP Fragment MS Protein Standard

Zinc finger with UFM1-specific peptidase domain protein

ZUFSP Fragment MS Protein Standard, is a protein fragment containing a 50-150 amino acid sequence identical to part of a human ZUFSP protein target. The fragment MS Protein Standard represents a new category of using heavy isotope labeled (15N, 13C) Lysine and Arginine residues resulting in more than 99% isotope incorporation, as internal MS standards offering distinct advantages to existing products for relative and absolute quantification.

ZUFSP

Q96AP4

RINTVQYGTSDNKKDNTLQCGMEVNSSILSGCASNHPKNSAQNLTKDSTLKHEGFYSENLTESRKFLKSREKQSSLTEIKGSVYETTY